Lineage for d5vf5a1 (5vf5 A:5-174)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424649Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2424650Protein automated matches [190388] (31 species)
    not a true protein
  7. 2424797Species Solanum melongena [TaxId:4111] [342484] (1 PDB entry)
  8. 2424798Domain d5vf5a1: 5vf5 A:5-174 [342485]
    automated match to d1ipkc1
    complexed with act, cu, mli, na, peg

Details for d5vf5a1

PDB Entry: 5vf5 (more details), 1.49 Å

PDB Description: crystal structure of the vicilin from solanum melongena, re-refinement
PDB Compounds: (A:) SM80.1 Vicilin

SCOPe Domain Sequences for d5vf5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vf5a1 b.82.1.0 (A:5-174) automated matches {Solanum melongena [TaxId: 4111]}
qqeenvpylfksqrfqsrfrashgdfrilpkftqrsqllrgiekfrvsvielepqsfmlp
hhcdgeaifvvvrgqgtisiaeqdeknsfnlergdvlrlhggstihllnrdnnekffvyv
laksvnapgqvqeyfsaggenpesfyrafssdilesafntqrdrierlfr

SCOPe Domain Coordinates for d5vf5a1:

Click to download the PDB-style file with coordinates for d5vf5a1.
(The format of our PDB-style files is described here.)

Timeline for d5vf5a1:

2424798
d5vf5a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5vf5a2