Lineage for d5v10a_ (5v10 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2551373Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2551374Protein automated matches [190143] (41 species)
    not a true protein
  7. 2551588Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [272670] (6 PDB entries)
  8. 2551607Domain d5v10a_: 5v10 A: [332269]
    automated match to d4i45a_
    complexed with cl

Details for d5v10a_

PDB Entry: 5v10 (more details), 1.9 Å

PDB Description: crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d5v10a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v10a_ d.38.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
raqhggkpfqqrfrvyyedtdaggivyyvnylkfmerarterlralgfaqsqlvgdnllf
vvhsaearyhapaklddellvsaeveelnraslkfrqqvrrasdsvllcegrflvacvra
dtlkpraipetlraafagspd

SCOPe Domain Coordinates for d5v10a_:

Click to download the PDB-style file with coordinates for d5v10a_.
(The format of our PDB-style files is described here.)

Timeline for d5v10a_:

2551607
d5v10a_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d5v10b_