Lineage for d5n4ta_ (5n4t A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheetsSuperfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) 
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) Protein automated matches [190079] (12 species)
not a true proteinSpecies Pseudomonas aeruginosa [TaxId:287] [189349] (76 PDB entries) 
Domain d5n4ta_: 5n4t A: [334224]
automated match to d5acwa_
complexed with bez, fmt, r59, zn
Details for d5n4ta_
PDB Entry: 5n4t (more details), 1.16 Å
PDB Description: vim-2 metallo-beta-lactamase in complex with ((s)-3-mercapto-2- methylpropanoyl)-l-tryptophan (compound 4)
PDB Compounds: (A:) beta-lactamase vim-2SCOPe Domain Sequences for d5n4ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n4ta_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
sgeyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawga
kntaallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegne
ipthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsag
nvadadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrs
SCOPe Domain Coordinates for d5n4ta_:
Click to download the PDB-style file with coordinates for d5n4ta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5n4ta_:
- d5n4ta_ first appeared in SCOPe 2.06
- d5n4ta_ appears in SCOPe 2.07
View in 3D
