Lineage for d5j75a2 (5j75 A:142-254)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2366875Domain d5j75a2: 5j75 A:142-254 [317056]
    automated match to d4f9lc1
    complexed with 6gq, po4

Details for d5j75a2

PDB Entry: 5j75 (more details), 2 Å

PDB Description: fluorogen activating protein am2.2 in complex with ml342
PDB Compounds: (A:) scFv AM2.2

SCOPe Domain Sequences for d5j75a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j75a2 b.1.1.0 (A:142-254) automated matches {Human (Homo sapiens) [TaxId: 9606]}
snfmltqppsasgtpgqsvtiscsgsgsnignnkvnwyqqlpgtapklliysnnqrpsgv
pdrfsgsksgtsaslaisglqsedeadyycaawddglsgyvfgtgtkltvlaa

SCOPe Domain Coordinates for d5j75a2:

Click to download the PDB-style file with coordinates for d5j75a2.
(The format of our PDB-style files is described here.)

Timeline for d5j75a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5j75a1