Lineage for d5huga_ (5hug A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2807607Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2808129Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2808130Protein automated matches [190692] (20 species)
    not a true protein
  7. 2808135Species Influenza A virus (a/american green-winged teal/washington/195750/2014(h5n1)) [TaxId:1609053] [315397] (1 PDB entry)
  8. 2808136Domain d5huga_: 5hug A: [315398]
    automated match to d4b7ra_
    complexed with ca, nag

Details for d5huga_

PDB Entry: 5hug (more details), 1.85 Å

PDB Description: the crystal structure of neuraminidase from a/american green-winged teal/washington/195750/2014 influenza virus
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d5huga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5huga_ b.68.1.0 (A:) automated matches {Influenza A virus (a/american green-winged teal/washington/195750/2014(h5n1)) [TaxId: 1609053]}
svalagnsslcpisgwaiyskdngirigskgdvfvirepfiscshlecrtffltqgalln
dkhsngtvkdrspyrtlmscpvgeapspynsrfesvawsasachdgiswltigisgpdng
avavlkyngiitdtikswrsnilrtqesecacingscftimtdgpsngqasykifkvekg
kvvksvelnapnyhyeecscypdasevmcvcrdnwhgsnrpwvsfnqnleyqigyicsgv
fgdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstssrsgfemiwdpngwt
etdssfsvkqeivaitdwsgysgsfvqhpeltgldcmrpcfwvelirgrpkentiwtsgs
sisfcgvnsdtvgwswpdgaelpftidk

SCOPe Domain Coordinates for d5huga_:

Click to download the PDB-style file with coordinates for d5huga_.
(The format of our PDB-style files is described here.)

Timeline for d5huga_: