Class b: All beta proteins [48724] (180 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.0: automated matches [191452] (1 protein) not a true family |
Protein automated matches [190692] (20 species) not a true protein |
Species Influenza A virus (a/american green-winged teal/washington/195750/2014(h5n1)) [TaxId:1609053] [315397] (1 PDB entry) |
Domain d5huga_: 5hug A: [315398] automated match to d4b7ra_ complexed with ca, nag |
PDB Entry: 5hug (more details), 1.85 Å
SCOPe Domain Sequences for d5huga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5huga_ b.68.1.0 (A:) automated matches {Influenza A virus (a/american green-winged teal/washington/195750/2014(h5n1)) [TaxId: 1609053]} svalagnsslcpisgwaiyskdngirigskgdvfvirepfiscshlecrtffltqgalln dkhsngtvkdrspyrtlmscpvgeapspynsrfesvawsasachdgiswltigisgpdng avavlkyngiitdtikswrsnilrtqesecacingscftimtdgpsngqasykifkvekg kvvksvelnapnyhyeecscypdasevmcvcrdnwhgsnrpwvsfnqnleyqigyicsgv fgdnprpndgtgscgpvssngaygvkgfsfkygngvwigrtkstssrsgfemiwdpngwt etdssfsvkqeivaitdwsgysgsfvqhpeltgldcmrpcfwvelirgrpkentiwtsgs sisfcgvnsdtvgwswpdgaelpftidk
Timeline for d5huga_: