Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily) N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet |
Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) |
Family e.7.1.0: automated matches [191440] (1 protein) not a true family |
Protein automated matches [190647] (17 species) not a true protein |
Species Medicago truncatula [TaxId:3880] [313744] (5 PDB entries) |
Domain d5eq9b_: 5eq9 B: [313776] automated match to d2bjia_ complexed with gol, hsa, mg |
PDB Entry: 5eq9 (more details), 1.36 Å
SCOPe Domain Sequences for d5eq9b_:
Sequence, based on SEQRES records: (download)
>d5eq9b_ e.7.1.0 (B:) automated matches {Medicago truncatula [TaxId: 3880]} hqlnhfsdvankaanaagdvirkyfrknnfdiihkndlspvtiadqsaeeamvsvildnf pshavygeekgwrckqdsadyvwvldpidgtksfitgkplfgtliallqngtpilgiidq pvlkerwigitgkrttlngqevstrtcadlsqaylyttsphlfsgdaeeafirvrdkvki plygcdcyayallssgfvdlvvesglkpydflalipviegsggvitdwkghqlrweaspl siatsfnvvaagdkqihqqaldslqw
>d5eq9b_ e.7.1.0 (B:) automated matches {Medicago truncatula [TaxId: 3880]} hqlnhfsdvankaanaagdvirkyfrknnfdlspvtiadqsaeeamvsvildnfpshavy geekgwrckqdsadyvwvldpidgtksfitgkplfgtliallqngtpilgiidqpvlker wigitgkrttlngqevstrtcadlsqaylyttsphlfsgdaeeafirvrdkvkiplygcd cyayallssgfvdlvvesglkpydflalipviegsggvitdwkghqlrweasplsiatsf nvvaagdkqihqqaldslqw
Timeline for d5eq9b_: