Lineage for d5d5ga_ (5d5g A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813364Fold b.78: beta-Prism II [51109] (1 superfamily)
    consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
    duplication: consists of two domains of this fold
  4. 2813365Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) (S)
  5. 2813417Family b.78.1.0: automated matches [191418] (1 protein)
    not a true family
  6. 2813418Protein automated matches [190587] (7 species)
    not a true protein
  7. 2813419Species Colocasia esculenta [TaxId:4460] [276542] (5 PDB entries)
  8. 2813446Domain d5d5ga_: 5d5g A: [276545]
    automated match to d3r0ea_
    complexed with epe, mg, so4

Details for d5d5ga_

PDB Entry: 5d5g (more details), 1.74 Å

PDB Description: structure of colocasia esculenta agglutinin
PDB Compounds: (A:) Tuber agglutinin

SCOPe Domain Sequences for d5d5ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d5ga_ b.78.1.0 (A:) automated matches {Colocasia esculenta [TaxId: 4460]}
lgtnyllsgqtldreghlkngdfdlvmqddcnlvlyngnwqsntankgrdckltltdyge
lvikngdgstvwrsraqsvkgnyaavvhpdgrlvvfgpsvfkidpwvpg

SCOPe Domain Coordinates for d5d5ga_:

Click to download the PDB-style file with coordinates for d5d5ga_.
(The format of our PDB-style files is described here.)

Timeline for d5d5ga_: