![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.78: beta-Prism II [51109] (1 superfamily) consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis duplication: consists of two domains of this fold |
![]() | Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) ![]() |
![]() | Family b.78.1.0: automated matches [191418] (1 protein) not a true family |
![]() | Protein automated matches [190587] (7 species) not a true protein |
![]() | Species Colocasia esculenta [TaxId:4460] [276542] (5 PDB entries) |
![]() | Domain d5d5ga_: 5d5g A: [276545] automated match to d3r0ea_ complexed with epe, mg, so4 |
PDB Entry: 5d5g (more details), 1.74 Å
SCOPe Domain Sequences for d5d5ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d5ga_ b.78.1.0 (A:) automated matches {Colocasia esculenta [TaxId: 4460]} lgtnyllsgqtldreghlkngdfdlvmqddcnlvlyngnwqsntankgrdckltltdyge lvikngdgstvwrsraqsvkgnyaavvhpdgrlvvfgpsvfkidpwvpg
Timeline for d5d5ga_: