Lineage for d5cm7a1 (5cm7 A:1-136)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960238Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 2960323Family d.79.4.0: automated matches [227181] (1 protein)
    not a true family
  6. 2960324Protein automated matches [226901] (10 species)
    not a true protein
  7. 2960325Species Acinetobacter baumannii [TaxId:470] [276302] (4 PDB entries)
  8. 2960326Domain d5cm7a1: 5cm7 A:1-136 [276303]
    Other proteins in same PDB: d5cm7a2, d5cm7b2
    automated match to d3mcqa1
    complexed with adp, ca, mg, na, tpp

Details for d5cm7a1

PDB Entry: 5cm7 (more details), 1.55 Å

PDB Description: structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with adenosine diphosphate (adp) and thiamine diphosphate (tpp)
PDB Compounds: (A:) Thiamine-monophosphate kinase

SCOPe Domain Sequences for d5cm7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cm7a1 d.79.4.0 (A:1-136) automated matches {Acinetobacter baumannii [TaxId: 470]}
maefsiidqyfnrqshpdvalgigddsalitpppnqqlvicadtlvagrhfpletsphai
gwksvavnlsdiaamgakphsillaislpqvdhewlegfsqgiydccnqfgvaliggdtt
qgphltitvtamgwie

SCOPe Domain Coordinates for d5cm7a1:

Click to download the PDB-style file with coordinates for d5cm7a1.
(The format of our PDB-style files is described here.)

Timeline for d5cm7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5cm7a2