Lineage for d5c4qa_ (5c4q A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2708294Species Leishmania donovani [TaxId:981087] [274710] (2 PDB entries)
  8. 2708295Domain d5c4qa_: 5c4q A: [274711]
    automated match to d1n72a_
    complexed with bmf, unx

Details for d5c4qa_

PDB Entry: 5c4q (more details), 1.93 Å

PDB Description: crystal structure analysis of bromodomain from leishmania donovani complexed with bromosporine
PDB Compounds: (A:) Bromodomain

SCOPe Domain Sequences for d5c4qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c4qa_ a.29.2.0 (A:) automated matches {Leishmania donovani [TaxId: 981087]}
mdvskrpreefhkeqclsfvkklwaadtlamfhypvsatevpgyydvvdtpmdlstirkn
ieqgkyrtdtevendvvlmlsnaldfnekgsqwhdlakqlkkryltlaqesglsfdad

SCOPe Domain Coordinates for d5c4qa_:

Click to download the PDB-style file with coordinates for d5c4qa_.
(The format of our PDB-style files is described here.)

Timeline for d5c4qa_:

2708295
d5c4qa_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d5c4qb_