SCOPe 2.08: Domain d5bk2d2: 5bk2 D:109-216

Lineage for d5bk2d2 (5bk2 D:109-216)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d5bk2d2: 5bk2 D:109-216 [346488]
Other proteins in same PDB: d5bk2a1, d5bk2a2, d5bk2b1, d5bk2b2, d5bk2c_, d5bk2d1, d5bk2h_, d5bk2l1
automated match to d1dn0a2
complexed with cl, gol, po4

Details for d5bk2d2

PDB Entry: 5bk2 (more details), 2.6 Å

PDB Description: crystal structure of maltose binding protein in complex with a peristeric synthetic antibody

PDB Compounds: (D:) SAB Light Chain

SCOPe Domain Sequences for d5bk2d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bk2d2 b.1.1.2 (D:109-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d5bk2d2:

Click to download the PDB-style file with coordinates for d5bk2d2.
(The format of our PDB-style files is described here.)

Timeline for d5bk2d2: