SCOPe 2.08: Domain d5bk2l1: 5bk2 L:1-108

Lineage for d5bk2l1 (5bk2 L:1-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5bk2l1: 5bk2 L:1-108 [346487]
   Other proteins in same PDB: d5bk2a1, d5bk2a2, d5bk2b1, d5bk2b2, d5bk2c_, d5bk2d2, d5bk2h_, d5bk2l2
   automated match to d1dn0a1
   complexed with cl, gol, po4

Details for d5bk2l1

PDB Entry: 5bk2, 2.6 Å

PDB Description: crystal structure of maltose binding protein in complex with a peristeric synthetic antibody

PDB Compounds: (L:) SAB Light Chain

SCOPe Domain Sequences for d5bk2l1:

Sequence; same for both SEQRES and ATOM records:

>d5bk2l1 b.1.1.0 (L:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
srfsgsrsgtdftltisslqpedfatyycqqyyygypitfgqgtkvei

Timeline for d5bk2l1:

• d5bk2l1 first appeared in SCOPe 2.07