| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d5bk2l1: 5bk2 L:1-108 [346487] Other proteins in same PDB: d5bk2a1, d5bk2a2, d5bk2b1, d5bk2b2, d5bk2c_, d5bk2d2, d5bk2h_, d5bk2l2 automated match to d1dn0a1 complexed with cl, gol, po4 |
PDB Entry: 5bk2 (more details), 2.6 Å
SCOPe Domain Sequences for d5bk2l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bk2l1 b.1.1.0 (L:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
srfsgsrsgtdftltisslqpedfatyycqqyyygypitfgqgtkvei
Timeline for d5bk2l1: