Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
Protein automated matches [190976] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188649] (54 PDB entries) |
Domain d5a41g_: 5a41 G: [276470] automated match to d3uyod_ complexed with f, na |
PDB Entry: 5a41 (more details), 2.17 Å
SCOPe Domain Sequences for d5a41g_:
Sequence, based on SEQRES records: (download)
>d5a41g_ b.1.2.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} svssvptklevvaatptslliswdayydevmyyritygetggnspvqeftvpgsstatis glkpgvdytitvyayydsyghwspisinyrt
>d5a41g_ b.1.2.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} svssvptklevvaatptslliswdayydevmyyritygetpvqeftvpgsstatisglkp gvdytitvyayydsyghwspisinyrt
Timeline for d5a41g_: