Lineage for d4ykib_ (4yki B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2523073Species Mnemiopsis leidyi [TaxId:27923] [278472] (6 PDB entries)
  8. 2523075Domain d4ykib_: 4yki B: [278475]
    automated match to d2i0cb_
    complexed with gly, mg, so4

Details for d4ykib_

PDB Entry: 4yki (more details), 1.21 Å

PDB Description: mnemiopsis leidyi ml032222a iglur lbd glycine complex
PDB Compounds: (B:) ML032222a iGluR

SCOPe Domain Sequences for d4ykib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ykib_ c.94.1.0 (B:) automated matches {Mnemiopsis leidyi [TaxId: 27923]}
gsknligrhlrlgsveeqpfmffategcegndcwsgmvndmvvklsedlgftyeyiqpdd
rkfgalnkttnewngmirdllddktdmiaidlstnsarksaidysfpfmdagikavvkge
gttlnqvlelldqdkykwgvigsrhpetllkthrdsrysrlvdegvelkdlnhaietlrg
glfvfidegpvlahnlisdcdvfsvgeefqsfeyafglpkdspykslidshllkfreegf
idilwekwssgnsvc

SCOPe Domain Coordinates for d4ykib_:

Click to download the PDB-style file with coordinates for d4ykib_.
(The format of our PDB-style files is described here.)

Timeline for d4ykib_: