SCOPe 2.07: Domain d4wsrd2: 4wsr D:329-498

Lineage for d4wsrd2 (4wsr D:329-498)

Root: SCOPe 2.07
Class h: Coiled coil proteins [57942] (7 folds)
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
core: trimeric coiled coil
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
Protein Influenza hemagglutinin (stalk) [58066] (17 species)
trimer
Species Influenza A virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId:402503] [269458] (2 PDB entries)
Domain d4wsrd2: 4wsr D:329-498 [269465]
Other proteins in same PDB: d4wsra1, d4wsrb1, d4wsrc1, d4wsrd1, d4wsre1, d4wsrf1
automated match to d1ha0a2
complexed with nag

Details for d4wsrd2

PDB Entry: 4wsr (more details), 2.5 Å

PDB Description: the crystal structure of hemagglutinin form a/chicken/new york/14677- 13/1998

PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d4wsrd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wsrd2 h.3.1.1 (D:329-498) Influenza hemagglutinin (stalk) {Influenza A virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId: 402503]}
glfgaiagfieggwtgmvdgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
tqfeavehefsnlekrisnlnkrmedgfldvwtynaellvllenertldmhdanvknlhe
kvksqlrdnakdlgngcfefwhkcdnecinsvkngtynypkyqeesrlnr

SCOPe Domain Coordinates for d4wsrd2:

Click to download the PDB-style file with coordinates for d4wsrd2.
(The format of our PDB-style files is described here.)

Timeline for d4wsrd2: