Lineage for d4urhc_ (4urh C:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624627Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2624628Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2624629Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 2624664Protein automated matches [190110] (7 species)
    not a true protein
  7. 2624704Species Desulfovibrio fructosovorans [TaxId:878] [188149] (12 PDB entries)
  8. 2624711Domain d4urhc_: 4urh C: [263998]
    Other proteins in same PDB: d4urhq_, d4urhr_, d4urhs_
    automated match to d1ubks_
    complexed with f3s, fco, gol, mg, ni, sf4

Details for d4urhc_

PDB Entry: 4urh (more details), 1.44 Å

PDB Description: high-resolution structure of partially oxidized d. fructosovorans nife-hydrogenase
PDB Compounds: (C:) Hydrogenase (NiFe) small subunit HydA

SCOPe Domain Sequences for d4urhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4urhc_ e.19.1.1 (C:) automated matches {Desulfovibrio fructosovorans [TaxId: 878]}
ltakhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaal
hqalegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggv
qkakpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfyg
elvhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvq
aghpclgcsepdfwdtmtpfyeqg

SCOPe Domain Coordinates for d4urhc_:

Click to download the PDB-style file with coordinates for d4urhc_.
(The format of our PDB-style files is described here.)

Timeline for d4urhc_: