Lineage for d4rwua_ (4rwu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2689868Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 2689904Family a.2.3.0: automated matches [191473] (1 protein)
    not a true family
  6. 2689905Protein automated matches [190750] (8 species)
    not a true protein
  7. 2689909Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [261980] (2 PDB entries)
  8. 2689910Domain d4rwua_: 4rwu A: [261981]
    automated match to d2ej7a_

Details for d4rwua_

PDB Entry: 4rwu (more details), 1.25 Å

PDB Description: j-domain of sis1 protein, hsp40 co-chaperone from saccharomyces cerevisiae
PDB Compounds: (A:) Protein SIS1

SCOPe Domain Sequences for d4rwua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rwua_ a.2.3.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mvketklydllgvspsaneqelkkgyrkaalkyhpdkptgdtekfkeiseafeilndpqk
reiydqygleaarsggpsfgp

SCOPe Domain Coordinates for d4rwua_:

Click to download the PDB-style file with coordinates for d4rwua_.
(The format of our PDB-style files is described here.)

Timeline for d4rwua_: