| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (74 species) not a true protein |
| Species Synechococcus elongatus [TaxId:269084] [261952] (2 PDB entries) |
| Domain d4ropa2: 4rop A:143-428 [261953] Other proteins in same PDB: d4ropa1 automated match to d2xsxa2 complexed with ca, cl, mg |
PDB Entry: 4rop (more details), 2.05 Å
SCOPe Domain Sequences for d4ropa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ropa2 c.1.11.0 (A:143-428) automated matches {Synechococcus elongatus [TaxId: 269084]}
anvlpvpmmnvinggahadnnvdfqefmimpvgapsfkealrwgaevfhalakvlkdkgl
atgvgdeggfapnlgsnkealellltaieaagykpgeqvalamdvassefyknglytcdg
vshepagmigiladlvsqypivsiedglqeddwsnwktltqqlgstvqlvgddlfvtnpd
rlqsgieqgvgnavliklnqigtltetlrtidlatrsgyrsvishrsgetedttiadlav
atragqiktgslsrseriakynrllrieaalgenalyagaiglgpk
Timeline for d4ropa2: