Lineage for d4r9kc_ (4r9k C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896198Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1896654Family d.17.4.8: Limonene-1,2-epoxide hydrolase-like [89854] (3 proteins)
    automatically mapped to Pfam PF07858
  6. 1896655Protein Limonene-1,2-epoxide hydrolase [89855] (1 species)
  7. 1896656Species Rhodococcus erythropolis [TaxId:1833] [89856] (9 PDB entries)
  8. 1896661Domain d4r9kc_: 4r9k C: [260011]
    automated match to d1nu3b_
    complexed with gol, hyh; mutant

Details for d4r9kc_

PDB Entry: 4r9k (more details), 1.5 Å

PDB Description: structure of thermostable eightfold mutant of limonene epoxide hydrolase from rhodococcus erythropolis
PDB Compounds: (C:) limonene-1,2-epoxide hydrolase

SCOPe Domain Sequences for d4r9kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r9kc_ d.17.4.8 (C:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]}
ieqprwaskdpaagkastpdekivlefmdaltsndaaklikyfaedtmyqnmplppaygr
daveqtlaglfkvmsidavevfhigsskglvftervdvlralptgksynlsilgvfqltd
gkitgwrdyfdlrefeeavdlplrgklgpeqkliseedln

SCOPe Domain Coordinates for d4r9kc_:

Click to download the PDB-style file with coordinates for d4r9kc_.
(The format of our PDB-style files is described here.)

Timeline for d4r9kc_: