Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.8: Limonene-1,2-epoxide hydrolase-like [89854] (3 proteins) automatically mapped to Pfam PF07858 |
Protein Limonene-1,2-epoxide hydrolase [89855] (1 species) |
Species Rhodococcus erythropolis [TaxId:1833] [89856] (9 PDB entries) |
Domain d4r9ka_: 4r9k A: [263829] automated match to d4r9kc_ complexed with gol, hyh; mutant |
PDB Entry: 4r9k (more details), 1.5 Å
SCOPe Domain Sequences for d4r9ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r9ka_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]} ieqprwaskdpaagkastpdekivlefmdaltsndaaklikyfaedtmyqnmplppaygr daveqtlaglfkvmsidavevfhigsskglvftervdvlralptgksynlsilgvfqltd gkitgwrdyfdlrefeeavdlplr
Timeline for d4r9ka_: