Class b: All beta proteins [48724] (176 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.0: automated matches [191391] (1 protein) not a true family |
Protein automated matches [190503] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [187451] (3 PDB entries) |
Domain d4phxc_: 4phx C: [259923] automated match to d2axwb_ |
PDB Entry: 4phx (more details), 2.4 Å
SCOPe Domain Sequences for d4phxc_:
Sequence, based on SEQRES records: (download)
>d4phxc_ b.2.3.0 (C:) automated matches {Escherichia coli [TaxId: 562]} aeitlishktlgsqlrdgmklatgriacrephdgfhiwinasqngkvghyivqnnretkh elkvkiggggwsssliegqrgvyrqgeekqaifdimsdgnqysapgeyifsvsgeclisr gdnkqalerppikatetirltv
>d4phxc_ b.2.3.0 (C:) automated matches {Escherichia coli [TaxId: 562]} aeitlishlgsqlrdgmklatgriacrephdgfhiwinasqngkvghyivqnnrhelkvk iggggwsssliegqrgvyrqgeekqaifdimsdgnqysapgeyifsvsgeclisqalerp pikatetirltv
Timeline for d4phxc_: