SCOPe 2.05: Domain d4phxe_: 4phx E:

Lineage for d4phxe_ (4phx E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.0: automated matches [191391] (1 protein)
   not a true family

6. Protein automated matches [190503] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187451] (3 PDB entries)

8. Domain d4phxe_: 4phx E: [263490]
   automated match to d4phxc_

Details for d4phxe_

PDB Entry: 4phx, 2.4 Å

PDB Description: crystal structure of aggb, the minor subunit of aggregative adherence fimbriae type i from the escherichia coli o4h104

PDB Compounds: (E:) Protein AggB

SCOPe Domain Sequences for d4phxe_:

Sequence, based on SEQRES records:

>d4phxe_ b.2.3.0 (E:) automated matches {Escherichia coli [TaxId: 562]}
aeitlishktlgsqlrdgmklatgriacrephdgfhiwinasqngkvghyivqnnretkh
elkvkiggggwsssliegqrgvyrqgeekqaifdimsdgnqysapgeyifsvsgeclisr
gdnkqalerppikatetirltv

Sequence, based on observed residues (ATOM records):

>d4phxe_ b.2.3.0 (E:) automated matches {Escherichia coli [TaxId: 562]}
aeitligsqlrdmklatgriacrephdgfhiwinasqhyivqnnrkhelkvkiggggwss
sliegqrgvyrqgeekqaifdimsdgnqysapgeyifsvsgeclisgnqalerppikate
tirltv

Timeline for d4phxe_:

• d4phxe_ is new in SCOPe 2.05-stable
  
• d4phxe_ is called d4phxe1 in SCOPe 2.06
  
• d4phxe_ appears in the current release, SCOPe 2.08, called d4phxe1