Lineage for d4ovsa_ (4ovs A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topology
Family c.94.1.0: automated matches [191309] (1 protein)
not a true familyProtein automated matches [190039] (120 species)
not a true protein
Species Sulfurospirillum deleyianum [TaxId:525898] [256378] (1 PDB entry) 
Domain d4ovsa_: 4ovs A: [254065]
automated match to d2ceya_
complexed with cl, sin
Details for d4ovsa_
PDB Entry: 4ovs (more details), 1.8 Å
PDB Description: crystal structure of a trap periplasmic solute binding protein from sulfurospirillum deleyianum dsm 6946 (sdel_0447), target efi-510309, with bound succinate
PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunitSCOPe Domain Sequences for d4ovsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ovsa_ c.94.1.0 (A:) automated matches {Sulfurospirillum deleyianum [TaxId: 525898]}
maeytikvthvvspntpkgkgadffakrvgeltngkvevivfpnsqlygdgeemkalklg
nahiampsfskftslvpemqlfdlpfifrdkdhlykvldgevgqilkdkvskkgfvaldy
wdagfkhlssnkkpillpedaagqkfrimsshvleaqfkavganpqvlpfsevysalqqg
vvdgaenplsnfytkkfnevqtdltlsnhgylgylvimsesfwkkfpkdlkpmvlqamke
ateyerkeaalddedmlakiseyakasgnlkihtltpeqkaawqkameaiypqfyktige
dlikkvqavk
SCOPe Domain Coordinates for d4ovsa_:
Click to download the PDB-style file with coordinates for d4ovsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ovsa_:
- d4ovsa_ first appeared in SCOPe 2.04
- d4ovsa_ is called d4ovsa1 in SCOPe 2.06
- d4ovsa_ appears in the current release, SCOPe 2.08, called d4ovsa1
View in 3D
