Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Sulfurospirillum deleyianum [TaxId:525898] [256378] (1 PDB entry) |
Domain d4ovsa1: 4ovs A:22-330 [254065] Other proteins in same PDB: d4ovsa2, d4ovsb2 automated match to d2ceya_ complexed with cl, sin |
PDB Entry: 4ovs (more details), 1.8 Å
SCOPe Domain Sequences for d4ovsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ovsa1 c.94.1.0 (A:22-330) automated matches {Sulfurospirillum deleyianum [TaxId: 525898]} aeytikvthvvspntpkgkgadffakrvgeltngkvevivfpnsqlygdgeemkalklgn ahiampsfskftslvpemqlfdlpfifrdkdhlykvldgevgqilkdkvskkgfvaldyw dagfkhlssnkkpillpedaagqkfrimsshvleaqfkavganpqvlpfsevysalqqgv vdgaenplsnfytkkfnevqtdltlsnhgylgylvimsesfwkkfpkdlkpmvlqamkea teyerkeaalddedmlakiseyakasgnlkihtltpeqkaawqkameaiypqfyktiged likkvqavk
Timeline for d4ovsa1: