Lineage for d4ovsa1 (4ovs A:22-330)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916206Species Sulfurospirillum deleyianum [TaxId:525898] [256378] (1 PDB entry)
  8. 2916207Domain d4ovsa1: 4ovs A:22-330 [254065]
    Other proteins in same PDB: d4ovsa2, d4ovsb2
    automated match to d2ceya_
    complexed with cl, sin

Details for d4ovsa1

PDB Entry: 4ovs (more details), 1.8 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from sulfurospirillum deleyianum dsm 6946 (sdel_0447), target efi-510309, with bound succinate
PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4ovsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ovsa1 c.94.1.0 (A:22-330) automated matches {Sulfurospirillum deleyianum [TaxId: 525898]}
aeytikvthvvspntpkgkgadffakrvgeltngkvevivfpnsqlygdgeemkalklgn
ahiampsfskftslvpemqlfdlpfifrdkdhlykvldgevgqilkdkvskkgfvaldyw
dagfkhlssnkkpillpedaagqkfrimsshvleaqfkavganpqvlpfsevysalqqgv
vdgaenplsnfytkkfnevqtdltlsnhgylgylvimsesfwkkfpkdlkpmvlqamkea
teyerkeaalddedmlakiseyakasgnlkihtltpeqkaawqkameaiypqfyktiged
likkvqavk

SCOPe Domain Coordinates for d4ovsa1:

Click to download the PDB-style file with coordinates for d4ovsa1.
(The format of our PDB-style files is described here.)

Timeline for d4ovsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ovsa2