Lineage for d4oqoa_ (4oqo A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163256Family c.94.1.2: Transferrin [53888] (4 proteins)
    further duplication: composed of two two-domain lobes
  6. 2163257Protein Lactoferrin [53889] (6 species)
  7. 2163263Species Cow (Bos taurus) [TaxId:9913] [53891] (19 PDB entries)
  8. 2163279Domain d4oqoa_: 4oqo A: [237718]
    automated match to d2q8ja_
    complexed with nag

Details for d4oqoa_

PDB Entry: 4oqo (more details), 2.42 Å

PDB Description: crystal structure of the tryptic generated iron-free c-lobe of bovine lactoferrin at 2.42 angstrom resolution
PDB Compounds: (A:) lactotransferrin

SCOPe Domain Sequences for d4oqoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oqoa_ c.94.1.2 (A:) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcstsplleacafltr

SCOPe Domain Coordinates for d4oqoa_:

Click to download the PDB-style file with coordinates for d4oqoa_.
(The format of our PDB-style files is described here.)

Timeline for d4oqoa_: