Class b: All beta proteins [48724] (178 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (19 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [255543] (3 PDB entries) |
Domain d4ooqa_: 4ooq A: [307933] complexed with mg, so4 |
PDB Entry: 4ooq (more details), 2 Å
SCOPe Domain Sequences for d4ooqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ooqa_ b.85.4.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} spffkvkklsekaviptrgsplsagydlssavdskvpargkaliptdlsiavpegtyari aprsglawkhsidvgagvidadyrgpvgvilfnhsdadfevkfgdriaqliiekivtpdv vevddldetvr
Timeline for d4ooqa_: