Lineage for d4odja3 (4odj A:260-406)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582960Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2582961Protein automated matches [254617] (15 species)
    not a true protein
  7. 2583018Species Cryptosporidium hominis [TaxId:237895] [256376] (3 PDB entries)
  8. 2583027Domain d4odja3: 4odj A:260-406 [254051]
    automated match to d2p02a3
    complexed with 3po, mg, sam

Details for d4odja3

PDB Entry: 4odj (more details), 1.6 Å

PDB Description: crystal structure of a putative s-adenosylmethionine synthetase from cryptosporidium hominis in complex with s-adenosyl-methionine
PDB Compounds: (A:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d4odja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4odja3 d.130.1.0 (A:260-406) automated matches {Cryptosporidium hominis [TaxId: 237895]}
iggpaadagltgrkiivdtyggwgahgggafsgkdatkvdrsgaymarlvaksivfsglc
srclvqvsygigiarplslyintfgtakdgyndtklleivnkvfdfrpgilikqlnlksp
ifkktssgghfgrsekeflwekpiilq

SCOPe Domain Coordinates for d4odja3:

Click to download the PDB-style file with coordinates for d4odja3.
(The format of our PDB-style files is described here.)

Timeline for d4odja3: