Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) |
Family d.15.6.0: automated matches [227139] (1 protein) not a true family |
Protein automated matches [226841] (5 species) not a true protein |
Species Staphylococcus aureus [TaxId:93061] [226096] (6 PDB entries) |
Domain d4o1na2: 4o1n A:102-202 [268437] Other proteins in same PDB: d4o1na1, d4o1nb1, d4o1nc1, d4o1nd1, d4o1ne1, d4o1nf1 automated match to d2z8la2 complexed with gol |
PDB Entry: 4o1n (more details), 2.5 Å
SCOPe Domain Sequences for d4o1na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o1na2 d.15.6.0 (A:102-202) automated matches {Staphylococcus aureus [TaxId: 93061]} qyidyintpileikkdnedvlkdfyyiskedislkeldyrlreraikqhglysnglkqgq ititmndgtthtidlsqklekermgesidgtkinkilvemk
Timeline for d4o1na2: