Lineage for d4nu7b_ (4nu7 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2435328Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2436130Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2436131Protein automated matches [190292] (37 species)
    not a true protein
  7. 2436462Species Toxoplasma gondii [TaxId:5811] [229953] (1 PDB entry)
  8. 2436464Domain d4nu7b_: 4nu7 B: [229954]
    automated match to d1h1ya_
    complexed with cl, so4, zn

Details for d4nu7b_

PDB Entry: 4nu7 (more details), 2.05 Å

PDB Description: 2.05 angstrom crystal structure of ribulose-phosphate 3-epimerase from toxoplasma gondii.
PDB Compounds: (B:) ribulose-phosphate 3-epimerase

SCOPe Domain Sequences for d4nu7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nu7b_ c.1.2.0 (B:) automated matches {Toxoplasma gondii [TaxId: 5811]}
qlkpiicpsvlasdlsslasdakrmvdagcdwlhldimdghfvpnisfgpgvvkalrghl
ksaffdvhlmvsepekwiqpfadagansitfhwesvggdlqraaelakriqargikagla
ikpatkfedlgealagdnfdmllvmtvepgfggqkfmadmlqkvrtarslfpklniqvdg
gldgetvkpaasaganvivagtsmfkaenpaalmtfmrdviaasd

SCOPe Domain Coordinates for d4nu7b_:

Click to download the PDB-style file with coordinates for d4nu7b_.
(The format of our PDB-style files is described here.)

Timeline for d4nu7b_: