Lineage for d4napb_ (4nap B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163712Species Desulfovibrio alaskensis [TaxId:207559] [267973] (2 PDB entries)
  8. 2163714Domain d4napb_: 4nap B: [266901]
    automated match to d4pdda_
    complexed with dtr

Details for d4napb_

PDB Entry: 4nap (more details), 2.3 Å

PDB Description: Crystal structure of a trap periplasmic solute binding protein from Desulfovibrio alaskensis G20 (DDE_0634), target EFI-510102, with bound d-tryptophan
PDB Compounds: (B:) Extracellular solute-binding protein, family 7

SCOPe Domain Sequences for d4napb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4napb_ c.94.1.0 (B:) automated matches {Desulfovibrio alaskensis [TaxId: 207559]}
qpvtlnyanfppastfpciqmeqwahevrtrtrgkvdvltypggtllgarnmlrgvmsgq
adigcislayhpgvfpvmsvfelplgftsaeaassvlwelysglrpaelervkvltmfts
apshfmtvtpvrslrdlqgmeirgagtlsaileklgatpvsmpmpevpeavqkgiikglf
tsldvmkdmnfaemtghvtradqavypfavimnreawerlspdvqqvldglaaehaawtg
ryldahvqdsmrwaeekhgvqvhtlpeediaamrrsvqplfdawaqraadkgadpdavmr
tvdalkaqy

SCOPe Domain Coordinates for d4napb_:

Click to download the PDB-style file with coordinates for d4napb_.
(The format of our PDB-style files is described here.)

Timeline for d4napb_: