Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (42 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255571] (3 PDB entries) |
Domain d4moca1: 4moc A:7-153 [345351] Other proteins in same PDB: d4moca3 automated match to d5t02f_ complexed with coa |
PDB Entry: 4moc (more details), 2.5 Å
SCOPe Domain Sequences for d4moca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4moca1 d.38.1.0 (A:7-153) automated matches {Human (Homo sapiens) [TaxId: 9606]} gevvmsqaiqpahatargelsagqllkwidttaclaaekhagvscvtasvddiqfeetar vgqvitikakvtrafstsmeisikvmvqdmltgieklvsvafstfvakpvgkekihlkpv tllteqdhvehnlaaerrkvrlqhedt
Timeline for d4moca1: