Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
Protein automated matches [190976] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188649] (68 PDB entries) |
Domain d4mmzc_: 4mmz C: [266751] Other proteins in same PDB: d4mmza1, d4mmza2, d4mmza3, d4mmza4 automated match to d2ocfd_ complexed with bma, cl, gol, man, mn, na, nag |
PDB Entry: 4mmz (more details), 3.1 Å
SCOPe Domain Sequences for d4mmzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mmzc_ b.1.2.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sdvprdlevvaatptslliswdapavtvryyritygetggnspvqeftvpgskstatisg lkpgvdytitvyavtprgdwnegskpisiny
Timeline for d4mmzc_:
View in 3D Domains from other chains: (mouse over for more information) d4mmza1, d4mmza2, d4mmza3, d4mmza4 |