Lineage for d4m7oa_ (4m7o A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2519619Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2519730Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2520116Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2520117Protein automated matches [190944] (40 species)
    not a true protein
  7. 2520248Species Staphylococcus epidermidis [TaxId:176280] [256363] (1 PDB entry)
  8. 2520249Domain d4m7oa_: 4m7o A: [253771]
    automated match to d1n2za_

Details for d4m7oa_

PDB Entry: 4m7o (more details), 2.02 Å

PDB Description: The crystal structure of a possible an iron-binding (periplasmic solute-binding) protein from Staphylococcus epidermidis ATCC 12228.
PDB Compounds: (A:) Iron-binding protein

SCOPe Domain Sequences for d4m7oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m7oa_ c.92.2.0 (A:) automated matches {Staphylococcus epidermidis [TaxId: 176280]}
kkyhriislipsnteilyrlgigedivgvstvddypkdvkkgkkqfdamnlnkeelikak
pdlilahesqknsagkvlkslkdkgvkvvyvkdaqsidetydtfksigqltdrekqakel
vdetkhnvdkiinsvpkhhkkqevfmevsskpdiytagkdtffndmlekldaknsfddvk
gwksvskesiikrnpdilistegksksdyiemikkrggfdkinavkntrietvdgdevsr
pgprideglkdlrddiyk

SCOPe Domain Coordinates for d4m7oa_:

Click to download the PDB-style file with coordinates for d4m7oa_.
(The format of our PDB-style files is described here.)

Timeline for d4m7oa_: