Lineage for d4m78n_ (4m78 N:)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.38: Sm-like fold [50181] (5 superfamilies)
core: barrel, open; n*=4, S*=8; meander; SH3-like topologySuperfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) 
Family b.38.1.0: automated matches [191538] (1 protein)
not a true familyProtein automated matches [190914] (7 species)
not a true protein
Species Saccharomyces cerevisiae [TaxId:559292] [228531] (2 PDB entries) 
Domain d4m78n_: 4m78 N: [228975]
automated match to d1d3bc_
protein/RNA complex
Details for d4m78n_
PDB Entry: 4m78 (more details), 2.79 Å
PDB Description: Crystal structure of Lsm2-8 complex, space group P21
PDB Compounds: (N:) u6 snrna-associated sm-like protein lsm4SCOPe Domain Sequences for d4m78n_:
Sequence, based on SEQRES records: (download)
>d4m78n_ b.38.1.0 (N:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
mlplylltnakgqqmqielkngeiiqgiltnvdnwmnltlsnvteyseesainsednaes
skavklneiyirgtfikfiklqdniid
Sequence, based on observed residues (ATOM records): (download)
>d4m78n_ b.38.1.0 (N:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
mlplylltnakgqqmqielkngeiiqgiltnvdnwmnltlsnvteysvklneiyirgtfi
kfiklqdniid
SCOPe Domain Coordinates for d4m78n_:
Click to download the PDB-style file with coordinates for d4m78n_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4m78n_:
- d4m78n_ is new in SCOPe 2.03-stable
- d4m78n_ appears in SCOPe 2.04
- d4m78n_ appears in the current release, SCOPe 2.08
View in 3D
