Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (22 species) includes rudiment esterase domain |
Species Influenza B virus [TaxId:416659] [228242] (1 PDB entry) |
Domain d4m44e_: 4m44 E: [228243] Other proteins in same PDB: d4m44b_, d4m44d_, d4m44f_ automated match to d1rvxa_ complexed with nag |
PDB Entry: 4m44 (more details), 2.5 Å
SCOPe Domain Sequences for d4m44e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m44e_ b.19.1.2 (E:) Hemagglutinin {Influenza B virus [TaxId: 416659]} drictgitssnsphvvktatqgevnvtgvipltttptkshfanlkgtktrgklcptclnc tdldvalgrpmcvgvtpsakasilhevrpvtsgcfpimhdrtkirqlpnllrgyekirls tqnvinaekapggpyrlgtsgscpnatsrsgffatmawavpkdnnktatnpltvevphic tkeedqitvwgfhsddktqmknlygdsnpqkftssangvtthyvsqiggfpdqtedgglp qsgrivvdymvqkpgktgtivyqrgillpqkvwcasgrskvikgslpligeadclhekyg glnkskpyytgehakaigncpiwvktplklangtkyrppakll
Timeline for d4m44e_: