Lineage for d4m44f_ (4m44 F:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 2592022Species Influenza B virus [TaxId:416659] [256362] (1 PDB entry)
  8. 2592025Domain d4m44f_: 4m44 F: [240517]
    Other proteins in same PDB: d4m44a_, d4m44c_, d4m44e_
    automated match to d1ti8b1
    complexed with nag

Details for d4m44f_

PDB Entry: 4m44 (more details), 2.5 Å

PDB Description: Crystal structure of hemagglutinin of influenza virus B/Yamanashi/166/1998 in complex with avian-like receptor LSTa
PDB Compounds: (F:) hemagglutinin HA2

SCOPe Domain Sequences for d4m44f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m44f_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza B virus [TaxId: 416659]}
ffgaiagfleggwegmiagwhgytshgahgvavaadlkstqeainkitknlnslselevk
nlqrlsgamdelhneileldekvddlradtissqielavllsnegiinsedehllalerk
lkkmlgpsavdigngcfetkhkcnqtcldriaagtfnagefslptfdslni

SCOPe Domain Coordinates for d4m44f_:

Click to download the PDB-style file with coordinates for d4m44f_.
(The format of our PDB-style files is described here.)

Timeline for d4m44f_: