Lineage for d4lwza_ (4lwz A:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the restProtein automated matches [190047] (24 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [186768] (124 PDB entries) 
Domain d4lwza_: 4lwz A: [229120]
automated match to d3sfva_
complexed with gdp, mg
Details for d4lwza_
PDB Entry: 4lwz (more details), 2.55 Å
PDB Description: Crystal structure of Myo5b globular tail domain in complex with inactive Rab11a
PDB Compounds: (A:) Ras-related protein Rab-11ASCOPe Domain Sequences for d4lwza_:
Sequence, based on SEQRES records: (download)
>d4lwza_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
tagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy
Sequence, based on observed residues (ATOM records): (download)
>d4lwza_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
taraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksdlrhl
ravptdearafaeknglsfietsaldstnveaafqtilteiy
SCOPe Domain Coordinates for d4lwza_:
Click to download the PDB-style file with coordinates for d4lwza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4lwza_:
- d4lwza_ first appeared in SCOPe 2.03
- d4lwza_ appears in SCOPe 2.05
- d4lwza_ appears in the current release, SCOPe 2.08
View in 3D
