Lineage for d4lm4b_ (4lm4 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1753307Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1753308Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1753715Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 1753716Protein automated matches [190983] (6 species)
    not a true protein
  7. 1753717Species Human (Homo sapiens) [TaxId:9606] [188676] (86 PDB entries)
  8. 1753740Domain d4lm4b_: 4lm4 B: [237996]
    automated match to d4lkqb_
    complexed with jpz, ni

Details for d4lm4b_

PDB Entry: 4lm4 (more details), 1.48 Å

PDB Description: Crystal structure of PDE10A2 with fragment ZT902
PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d4lm4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lm4b_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tsictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelek
lcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldh
rgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiir
kaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkl
tandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpp
tepllkacrdnlsqwekvirgeetatw

SCOPe Domain Coordinates for d4lm4b_:

Click to download the PDB-style file with coordinates for d4lm4b_.
(The format of our PDB-style files is described here.)

Timeline for d4lm4b_: