Lineage for d4la4a_ (4la4 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1838447Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1838906Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 1838907Protein automated matches [190158] (18 species)
    not a true protein
  7. 1838994Species Pseudomonas sp. [TaxId:165468] [256995] (2 PDB entries)
  8. 1838999Domain d4la4a_: 4la4 A: [256996]
    automated match to d1ydga_

Details for d4la4a_

PDB Entry: 4la4 (more details), 2.07 Å

PDB Description: Crystal structure of native PnpB
PDB Compounds: (A:) NAD(P)H dehydrogenase (quinone)

SCOPe Domain Sequences for d4la4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4la4a_ c.23.5.0 (A:) automated matches {Pseudomonas sp. [TaxId: 165468]}
ptkiqivfyssyghiykmaeaiaagarevgdvevtllqvpelmpeevqvksgikgyraaf
gsipyatpevlaeadaiifgtptrfgnmcsqmrnfldqtgglwmsggligkvgsvftsta
sqhggqettitsfhttllhhgmvivgvpysepgltnmteisggtpygastlagadgsrqp
senelqiarfqgkhvatiakrlannk

SCOPe Domain Coordinates for d4la4a_:

Click to download the PDB-style file with coordinates for d4la4a_.
(The format of our PDB-style files is described here.)

Timeline for d4la4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4la4b_