![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (26 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries) |
![]() | Domain d4kv5f_: 4kv5 F: [259779] Other proteins in same PDB: d4kv5a_, d4kv5b_, d4kv5c_, d4kv5d_ automated match to d2ybrh_ |
PDB Entry: 4kv5 (more details), 3 Å
SCOPe Domain Sequences for d4kv5f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kv5f_ b.1.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} letvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgi pdrfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrleikr
Timeline for d4kv5f_: