Lineage for d4kv5f_ (4kv5 F:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1766461Domain d4kv5f_: 4kv5 F: [259779]
    Other proteins in same PDB: d4kv5a_, d4kv5b_, d4kv5c_, d4kv5d_
    automated match to d2ybrh_

Details for d4kv5f_

PDB Entry: 4kv5 (more details), 3 Å

PDB Description: scfv gc1009 in complex with tgf-beta1.
PDB Compounds: (F:) light chain GC1009 scFv

SCOPe Domain Sequences for d4kv5f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kv5f_ b.1.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
letvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgi
pdrfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrleikr

SCOPe Domain Coordinates for d4kv5f_:

Click to download the PDB-style file with coordinates for d4kv5f_.
(The format of our PDB-style files is described here.)

Timeline for d4kv5f_: