SCOPe 2.06: Domain d4kv5f1: 4kv5 F:0-108

Lineage for d4kv5f1 (4kv5 F:0-108)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4kv5f1: 4kv5 F:0-108 [259779]
   Other proteins in same PDB: d4kv5a_, d4kv5b_, d4kv5c_, d4kv5d_, d4kv5f2, d4kv5i2, d4kv5k2, d4kv5l2
   automated match to d2ybrh_

Details for d4kv5f1

PDB Entry: 4kv5, 3 Å

PDB Description: scfv gc1009 in complex with tgf-beta1.

PDB Compounds: (F:) light chain GC1009 scFv

SCOPe Domain Sequences for d4kv5f1:

Sequence; same for both SEQRES and ATOM records:

>d4kv5f1 b.1.1.0 (F:0-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
letvltqspgtlslspgeratlscrasqslgssylawyqqkpgqaprlliygassrapgi
pdrfsgsgsgtdftltisrlepedfavyycqqyadspitfgqgtrleik

Timeline for d4kv5f1:

• d4kv5f1 first appeared in SCOPe 2.04, called d4kv5f_
  
• d4kv5f1 was called d4kv5f_ in SCOPe 2.05
  
• d4kv5f1 last appears in SCOPe 2.07