Lineage for d4kpub_ (4kpu B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2469527Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2469806Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2469807Protein automated matches [190116] (28 species)
    not a true protein
  7. 2469811Species Acidaminococcus fermentans [TaxId:591001] [236033] (2 PDB entries)
  8. 2469813Domain d4kpub_: 4kpu B: [236034]
    automated match to d1o97c_
    complexed with cl, fad

Details for d4kpub_

PDB Entry: 4kpu (more details), 1.6 Å

PDB Description: Electron transferring flavoprotein of Acidaminococcus fermentans: Towards a mechanism of flavin-based electron bifurcation
PDB Compounds: (B:) Electron transfer flavoprotein alpha/beta-subunit

SCOPe Domain Sequences for d4kpub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kpub_ c.26.2.0 (B:) automated matches {Acidaminococcus fermentans [TaxId: 591001]}
mnivvcvkqvpdtaemkidpvtnnlvrdgvtnimnpydqyaletalqlkdelgahvtvit
mgpphaesvlrdclavgadeaklvsdrafggadtlatsaamantikhfgvpdlilcgrqa
idgdtaqvgpeiaehlglpqvtaalkvqvkddtvvvdrdneqmsmtftmkmpcvvtvmrs
kdlrfasirgkmkarkaeipvytaaaleipldiigkagsptqvmksftpkvtqvhgeifd
dedpavavdklvnkliedkiitk

SCOPe Domain Coordinates for d4kpub_:

Click to download the PDB-style file with coordinates for d4kpub_.
(The format of our PDB-style files is described here.)

Timeline for d4kpub_: