Lineage for d4jxda_ (4jxd A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
Superfamily c.44.2: PTS system IIB component-like [52794] (3 families) 
Family c.44.2.0: automated matches [254256] (1 protein)
not a true familyProtein automated matches [254590] (4 species)
not a true proteinSpecies Escherichia coli [TaxId:83333] [256814] (2 PDB entries) 
Domain d4jxda_: 4jxd A: [256815]
automated match to d2kyra_
complexed with ni
Details for d4jxda_
PDB Entry: 4jxd (more details), 2.4 Å
PDB Description: crystal structure of predicted fructose specific iib from escherichia coli
PDB Compounds: (A:) Fructose-like phosphotransferase enzyme IIB component 3SCOPe Domain Sequences for d4jxda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jxda_ c.44.2.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
maylvavtacvsgvahtymaaerleklcllekwgvsietqgalgtenrladedirradva
llitdielagaerfehcryvqcsiyaflrepqrvmsavrkvlsapqqthlile
SCOPe Domain Coordinates for d4jxda_:
Click to download the PDB-style file with coordinates for d4jxda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4jxda_:
- d4jxda_ first appeared in SCOPe 2.04
- d4jxda_ does not appear in SCOPe 2.06
View in 3D
