Lineage for d4jxda_ (4jxd A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1851592Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 1851718Superfamily c.44.2: PTS system IIB component-like [52794] (3 families) (S)
  5. 1851740Family c.44.2.0: automated matches [254256] (1 protein)
    not a true family
  6. 1851741Protein automated matches [254590] (4 species)
    not a true protein
  7. 1851749Species Escherichia coli [TaxId:83333] [256814] (2 PDB entries)
  8. 1851752Domain d4jxda_: 4jxd A: [256815]
    automated match to d2kyra_
    complexed with ni

Details for d4jxda_

PDB Entry: 4jxd (more details), 2.4 Å

PDB Description: crystal structure of predicted fructose specific iib from escherichia coli
PDB Compounds: (A:) Fructose-like phosphotransferase enzyme IIB component 3

SCOPe Domain Sequences for d4jxda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jxda_ c.44.2.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}
maylvavtacvsgvahtymaaerleklcllekwgvsietqgalgtenrladedirradva
llitdielagaerfehcryvqcsiyaflrepqrvmsavrkvlsapqqthlile

SCOPe Domain Coordinates for d4jxda_:

Click to download the PDB-style file with coordinates for d4jxda_.
(The format of our PDB-style files is described here.)

Timeline for d4jxda_: