Lineage for d4jq6a_ (4jq6 A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252282Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2252283Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2252559Family f.13.1.0: automated matches [227143] (1 protein)
    not a true family
  6. 2252560Protein automated matches [226845] (16 species)
    not a true protein
  7. 2252662Species Uncultured bacterium [TaxId:77133] [226659] (1 PDB entry)
  8. 2252663Domain d4jq6a_: 4jq6 A: [223936]
    automated match to d1brxa_
    complexed with li1, ret

Details for d4jq6a_

PDB Entry: 4jq6 (more details), 2.31 Å

PDB Description: Crystal structure of blue light-absorbing proteorhodopsin from Med12 at 2.3 Angstrom
PDB Compounds: (A:) Proteorhodopsin

SCOPe Domain Sequences for d4jq6a_:

Sequence, based on SEQRES records: (download)

>d4jq6a_ f.13.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}
dyvgisfwlaaaimlastvfffversdvpvkwktsltvaglvtgvafwhylymrgvwiya
getptvfryidwlitvplqiiefyliiaavtaissavfwklliaslvmliggfigeaglg
dvvvwwivgmiawlyiiyeiflgetakanagsgnaasqqafntikwivtvgwaiypigya
wgyfgdglnedalnivynladlinkaafglaiwaaamkdkets

Sequence, based on observed residues (ATOM records): (download)

>d4jq6a_ f.13.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}
dyvgisfwlaaaimlastvfffversdvpvkwktsltvaglvtgvafwhylymrgvwiya
getptvfryidwlitvplqiiefyliiavfwklliaslvmliggfigeaglgdvvvwwiv
gmiawlyiiyeiflfntikwivtvgwaiypigyawgyfgdglnedalnivynladlinka
afglaiwaaamkdkets

SCOPe Domain Coordinates for d4jq6a_:

Click to download the PDB-style file with coordinates for d4jq6a_.
(The format of our PDB-style files is described here.)

Timeline for d4jq6a_: