Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) |
Family c.42.1.0: automated matches [191435] (1 protein) not a true family |
Protein automated matches [190626] (14 species) not a true protein |
Species Trypanosome (Leishmania mexicana) [TaxId:5665] [226579] (7 PDB entries) |
Domain d4iu0a_: 4iu0 A: [223389] automated match to d1wvaa1 complexed with abh, gol, mn |
PDB Entry: 4iu0 (more details), 1.77 Å
SCOPe Domain Sequences for d4iu0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iu0a_ c.42.1.0 (A:) automated matches {Trypanosome (Leishmania mexicana) [TaxId: 5665]} kkmsivlapfsggqphsgvelgpdyllkqglqqdmeklgwdtrlervfdgkvvearkasd ngdrigrvkrprltaectekiykcvrrvaeqgrfpltiggdhsialgtvagvlsvhpdag viwvdahadintmsgtvsgnlhgcplsillgldrenipecfswvpqvlkpnkiayiglra vddeekkilhdlniaafsmhhvdrygidkvvsmaieavspkgtepvmvsydvdtidplyv patgtpvrgglsfrealflceriaecgrlvaldvvecnpllaateshvndtisvgcaiar cmmgetllyt
Timeline for d4iu0a_: