Lineage for d4il6o_ (4il6 O:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1955624Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 1955625Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 1955660Family f.4.1.4: PsbO-like [161115] (2 proteins)
    Pfam PF01716; MSP
  6. 1955661Protein Manganese-stabilising protein, PsbO [161116] (2 species)
  7. 1955664Species Thermosynechococcus vulcanus [TaxId:32053] [189919] (5 PDB entries)
  8. 1955665Domain d4il6o_: 4il6 O: [196652]
    Other proteins in same PDB: d4il6a_, d4il6b_, d4il6c_, d4il6d_, d4il6e_, d4il6f_, d4il6h_, d4il6j_, d4il6k_, d4il6l_, d4il6m_, d4il6u_, d4il6v_, d4il6x_, d4il6z_
    automated match to d3arco_
    complexed with bcr, bct, cl, cla, dgd, dms, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oer, pho, pl9, sqd, unl

Details for d4il6o_

PDB Entry: 4il6 (more details), 2.1 Å

PDB Description: structure of sr-substituted photosystem ii
PDB Compounds: (O:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d4il6o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4il6o_ f.4.1.4 (O:) Manganese-stabilising protein, PsbO {Thermosynechococcus vulcanus [TaxId: 32053]}
qtltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqe
aefvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftv
knlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeel
aranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyas
iepa

SCOPe Domain Coordinates for d4il6o_:

Click to download the PDB-style file with coordinates for d4il6o_.
(The format of our PDB-style files is described here.)

Timeline for d4il6o_: