Lineage for d4il6l_ (4il6 L:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1957421Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
    not a true fold
  4. 1958442Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
    automatically mapped to Pfam PF02419
  5. 1958443Family f.23.31.1: PsbL-like [161018] (2 proteins)
    Pfam PF02419
  6. 1958444Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)
  7. 1958448Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (5 PDB entries)
  8. 1958449Domain d4il6l_: 4il6 L: [192656]
    Other proteins in same PDB: d4il6a_, d4il6b_, d4il6c_, d4il6d_, d4il6e_, d4il6f_, d4il6h_, d4il6j_, d4il6k_, d4il6m_, d4il6o_, d4il6u_, d4il6v_, d4il6x_, d4il6z_
    automated match to d2axtl1
    complexed with bcr, bct, cl, cla, dgd, dms, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oer, pho, pl9, sqd, unl

Details for d4il6l_

PDB Entry: 4il6 (more details), 2.1 Å

PDB Description: structure of sr-substituted photosystem ii
PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d4il6l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4il6l_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d4il6l_:

Click to download the PDB-style file with coordinates for d4il6l_.
(The format of our PDB-style files is described here.)

Timeline for d4il6l_: