Lineage for d4i9ha1 (4i9h A:1-159)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) 
Protein automated matches [226881] (8 species)
not a true protein
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225718] (6 PDB entries) 
Domain d4i9ha1: 4i9h A:1-159 [223034]
Other proteins in same PDB: d4i9ha2, d4i9hb2, d4i9hc2, d4i9hd2, d4i9he2, d4i9hf2, d4i9hg2, d4i9hh2
automated match to d9ldta1
complexed with 1e4
Details for d4i9ha1
PDB Entry: 4i9h (more details), 2.17 Å
PDB Description: Crystal structure of rabbit LDHA in complex with AP28669
PDB Compounds: (A:) L-lactate dehydrogenase A chainSCOPe Domain Sequences for d4i9ha1:
Sequence, based on SEQRES records: (download)
>d4i9ha1 c.2.1.5 (A:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig
Sequence, based on observed residues (ATOM records): (download)
>d4i9ha1 c.2.1.5 (A:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqlnlvqrnvnifkfiipnvvky
sphckllvvsnpvdiltyvawkisgfpknrvig
SCOPe Domain Coordinates for d4i9ha1:
Click to download the PDB-style file with coordinates for d4i9ha1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4i9ha1:
- d4i9ha1 first appeared in SCOPe 2.03
- d4i9ha1 appears in SCOPe 2.06
- d4i9ha1 appears in the current release, SCOPe 2.08
View in 3D
