Lineage for d4i5ia_ (4i5i A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-likeSuperfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) 
binds cofactor molecules in the opposite direction than classical Rossmann foldFamily c.31.1.0: automated matches [191352] (1 protein)
not a true familyProtein automated matches [190312] (14 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [224883] (17 PDB entries) 
Domain d4i5ia_: 4i5i A: [260889]
automated match to d4ig9g_
complexed with 4i5, nad, zn
Details for d4i5ia_
PDB Entry: 4i5i (more details), 2.5 Å
PDB Description: Crystal structure of the SIRT1 catalytic domain bound to NAD and an EX527 analog
PDB Compounds: (A:) NAD-dependent protein deacetylase sirtuin-1SCOPe Domain Sequences for d4i5ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i5ia_ c.31.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntiedavkllqeckkiivltgagvsvscgipdfrsrdgiyarlavdfpdlpdpqamfdie
yfrkdprpffkfakeiypgqfqpslchkfialsdkegkllrnytqnidtleqvagiqrii
qchgsfatasclickykvdceavrgdifnqvvprcprcpadeplaimkpeivffgenlpe
qfhramkydkdevdllivigsslkvrpvalipssiphevpqilinreplphlhfdvellg
dcdviinelchrlggeyaklccnpvklseite
SCOPe Domain Coordinates for d4i5ia_:
Click to download the PDB-style file with coordinates for d4i5ia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4i5ia_:
- d4i5ia_ first appeared in SCOPe 2.04
- d4i5ia_ appears in SCOPe 2.07
View in 3D
