Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (32 species) not a true protein |
Species Photobacterium profundum [TaxId:74109] [196962] (2 PDB entries) |
Domain d4i45a_: 4i45 A: [196963] automated match to d1s5ue_ complexed with mg |
PDB Entry: 4i45 (more details), 1.4 Å
SCOPe Domain Sequences for d4i45a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i45a_ d.38.1.0 (A:) automated matches {Photobacterium profundum [TaxId: 74109]} skiyhhpvqiyyedtdhsgvvyhpnflkyferarehvidsdklatlwndhglgfavykan mifqdgvefaeicdirtsftldgkyktlwrqevwrpgasraavigdiemvcldkekrlqp vpadilasm
Timeline for d4i45a_: