Lineage for d4i45a_ (4i45 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901753Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1901754Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1902478Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 1902479Protein automated matches [190143] (32 species)
    not a true protein
  7. 1902597Species Photobacterium profundum [TaxId:74109] [196962] (2 PDB entries)
  8. 1902599Domain d4i45a_: 4i45 A: [196963]
    automated match to d1s5ue_
    complexed with mg

Details for d4i45a_

PDB Entry: 4i45 (more details), 1.4 Å

PDB Description: Crystal Structure of Orf6 protein from Photobacterium profundum, Mg2+-bound form
PDB Compounds: (A:) ORF6 thioesterase

SCOPe Domain Sequences for d4i45a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i45a_ d.38.1.0 (A:) automated matches {Photobacterium profundum [TaxId: 74109]}
skiyhhpvqiyyedtdhsgvvyhpnflkyferarehvidsdklatlwndhglgfavykan
mifqdgvefaeicdirtsftldgkyktlwrqevwrpgasraavigdiemvcldkekrlqp
vpadilasm

SCOPe Domain Coordinates for d4i45a_:

Click to download the PDB-style file with coordinates for d4i45a_.
(The format of our PDB-style files is described here.)

Timeline for d4i45a_: