Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
Protein automated matches [190403] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187277] (10 PDB entries) |
Domain d4hsvc_: 4hsv C: [196784] automated match to d1f9qd_ |
PDB Entry: 4hsv (more details), 2.08 Å
SCOPe Domain Sequences for d4hsvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hsvc_ d.9.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qclcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqallykkiikeh
Timeline for d4hsvc_: